Protein Info for GFF5184 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 59 to 241 (183 residues), 174.3 bits, see alignment E=9.1e-56 PF02390: Methyltransf_4" amino acids 66 to 237 (172 residues), 178 bits, see alignment E=6.1e-57

Best Hits

Swiss-Prot: 74% identical to TRMB_ACIAC: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 74% identity to aaa:Acav_2250)

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF5184 tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTDPRHAQPRPAPADTTFMREVKSYVLRAGRMGPGQARAFEQHGPRFLLNYAPGAFDAAA
AFGRDAPLIMEIGFGMGGATAHIAAVRPQDNFLCCEVHEPGVGALLKLVGEQGLENIRIF
RHDAVEVLDHMLGEASLDGVHIFFPDPWHKSRHHKRRLIQGPFVNRLARHLKPGGYLHLA
TDWEPYAQQMLEVLNAEPLLRNTAAPGGDGFVPKPDYRPLTKFENRGLKLGHGVWDLVFR
RV