Protein Info for GFF5183 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: glutamyl-Q-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 2 to 273 (272 residues), 380.4 bits, see alignment E=2.4e-118 PF00749: tRNA-synt_1c" amino acids 3 to 273 (271 residues), 151.7 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 64% identical to GLUQ_LEPCP: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 68% identity to mpt:Mpe_A2900)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF5183 glutamyl-Q-tRNA synthetase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MYRGRFAPSPTGPLHAGSLVAALASWLDARAHGGVWLVRIEDVDTPRCVPGADDTILRQL
AACGLVSDEPVVWQTQRGPRYQQMLDQLVTLGRAYPCACSRKDIEATLQAQGLVRERHHI
AVYPGTCRPERGGLHGQPARAWRFAIDPAHSIVRWTDRQLGPQAQDVATEVGDFVLKRAD
GLWAYQLAVVVDDAAQDITHVVRGEDLADNTARQIQLQLALGLPTPAYRHTPLVLGDNGE
KLSKQNGAQPLDLSDPSMALVQAARALGLPAPGRDTVANLLAAWTQAWPA