Protein Info for GFF5174 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tol biopolymer transport system, TolR protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details PF02472: ExbD" amino acids 13 to 145 (133 residues), 107.3 bits, see alignment E=3.1e-35

Best Hits

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 57% identity to mpt:Mpe_A2955)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>GFF5174 Tol biopolymer transport system, TolR protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPAVSSRGRGRRTINEINMVPFIDVMLVLLIIFMVTAPLITPSQIALPSVGQAGRQPDRF
VAVVIDKDEQIKVREGSSSAEPQPVSMGQLVARVQQLQASRGSPPEGGVPVVISADKNVK
YEAVVRVMDTLQRAGIARVGLSVQTSR