Protein Info for PS417_02630 in Pseudomonas simiae WCS417

Annotation: NAD synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02540: NAD_synthase
  • amino acids 28 to 272 (245 residues), 210.1 bits, E=1.4e-66
• TIGR00552: NAD+ synthetase
  • amino acids 30 to 272 (243 residues), 215.3 bits, E=4.2e-68

Best Hits

Swiss-Prot: 89% identical to NADE_PSEPF: NH(3)-dependent NAD(+) synthetase (nadE) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 98% identity to pfs:PFLU0546)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD de novo biosynthesis III (4/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.5

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

See A0A1N7TVQ9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>PS417_02630 NAD synthetase (Pseudomonas simiae WCS417)
MQAVQREIAEQLKVQAPFNDQAALEAEVARRVTFIQDCLRNSGLKTLVLGISGGVDSLTA
GLLAQRAMKELREHTGDEAYRFIAVRLPYETQFDEIDATASVDFIEPDERHTVNIGPAVK
ALANEVAAFEGKAAVSRDFVLGNTKARMRMVAQYTIAGAAGGLVIGTDHAAEAVMGFFTK
FGDGACDLAPLSGLVKNQVRAIARHFGAPESLVEKVPTADLEDLSPGKPDEASHGVTYAE
IDAFLHGEPVREEAFRIICDTYRKTEHKRVMPFAP