Protein Info for PS417_26405 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 PF00072: Response_reg" amino acids 15 to 126 (112 residues), 89 bits, see alignment E=4.9e-29 PF08448: PAS_4" amino acids 157 to 265 (109 residues), 27.6 bits, see alignment E=5.9e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 271 to 434 (164 residues), 145.8 bits, see alignment E=1e-46 PF00990: GGDEF" amino acids 275 to 431 (157 residues), 146.3 bits, see alignment E=1.4e-46 PF00563: EAL" amino acids 451 to 685 (235 residues), 219.4 bits, see alignment E=9.3e-69

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU5698)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UM69 at UniProt or InterPro

Protein Sequence (701 amino acids)

>PS417_26405 diguanylate cyclase (Pseudomonas simiae WCS417)
MECAPHHADGSSVLLVVDDYPENLVSMRALLQREDWRVITAGSGLEALELLLAHDVDLVL
LDVRMPGMDGFEVARLMRGSQRTCMTPIIFLTANAQSPAAVLEGYASGAVDYLFKPFDPN
ILKPKVQALLEHQRNRRALQRLSHDLESARAFNASVLDNAAEGILVVGEGSVIEYANPAI
SRLLNATMTELQGESFLSFLQKPHVPAWLGFPMFEAYRKGETWRQHDAILRTGRGQQVPV
ALSCAPLPAEQKAMVVTVLDMSEVRHLHQQLEFQAVTDPLTGLLNRRGFHQAVENMLLRS
ERNEQSLVLLYLDLDGFKRVNDSLGHDAGDRVLRWVSEQMQACLRSGDMLGRMGGDEFTA
LLELEFPEQAAKIAEKLIERVSVCQQIDGLDVMLGVSIGIAMFPECGSDLSGLLRAADIA
MYEAKRAGRQQYRYYDQEMNGRARSRLMLEDSVRTAIQNKDFTLVYQPQVSLEGGRLRGV
EALLRWQHPSVGDVPPGLFLPLLEEARLISQLSTWIYQQVAAQRQAWQSAFDEELVLSVS
LSSSQFNMPNLAAQLQQVIERHGLQGRQLEVEISEDCLMSNLEESTKQLKLLRQIGVRTA
LDDFGLGNCSLAHLRDLAFDTLKLDPQLVARLPDSARDAVMARSIIELCGHFDVVVVAEG
VETQEQARWLKANGCPFIQGPIAASPLMAEEVADWSRARAC