Protein Info for GFF5153 in Variovorax sp. SCN45
Annotation: Putative ROK-family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 89% identity to vpe:Varpa_1046)Predicted SEED Role
"Mlc, transcriptional repressor of MalT (the transcriptional activator of maltose regulon) and manXYZ operon" in subsystem Maltose and Maltodextrin Utilization
MetaCyc Pathways
- Bifidobacterium shunt (15/15 steps found)
- homolactic fermentation (12/12 steps found)
- glycolysis III (from glucose) (11/11 steps found)
- heterolactic fermentation (15/18 steps found)
- glycogen degradation I (7/8 steps found)
- trehalose degradation IV (3/3 steps found)
- glycogen degradation II (5/6 steps found)
- sucrose biosynthesis II (6/8 steps found)
- sucrose degradation III (sucrose invertase) (3/4 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
- trehalose degradation I (low osmolarity) (1/2 steps found)
- trehalose degradation II (cytosolic) (1/2 steps found)
- glucose and glucose-1-phosphate degradation (3/5 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
- 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
- chitin biosynthesis (5/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Starch and sucrose metabolism
- Streptomycin biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (308 amino acids)
>GFF5153 Putative ROK-family transcriptional regulator (Variovorax sp. SCN45) MRACVDIGGTKVAVSLSPSSEAPLVGRRSEPTAKTGDNDAVAVQIIRMIEEVCAEQGVDP ASIDRVGVSSTGPFELHDGLVELATPNICGGIAGPSRGLPNSWMTAIVEAPLVKRFGSVR VENDAVAALEAERHWGALKGLDNCAYATWSTGVGVGLCVDGRALRGKNGNAGHAGHSFVV DDTSGALCGCGNYGDVEALVSGSSIEHRFGQSAAELFNAASAGEPEALEIAEALCRVVGR MLYNMVITLDLQRISLGGSVFWHHRDFVLPRLQAQIDGKLLPLTRGVLLVPAGLGDKVGD YAALALLD