Protein Info for GFF5150 in Variovorax sp. SCN45

Annotation: Taurine ABC transporter, permease protein TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 272 (173 residues), 63.4 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 94% identity to vpe:Varpa_1042)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF5150 Taurine ABC transporter, permease protein TauC (Variovorax sp. SCN45)
MSTLTPPIRPEYERQLEPFTELPVERTLPLGTRIWSQAWLRKGLILVVIAVLWELAARWQ
DNDLLLPTFTATARALVEGLASGELIEKVRISLAVLLQGYLAGVLLAFALTTLAVSTQIG
RDLLDTLTSMFNPLPAIALLPLALLWFGLGRGSLVFVLIHSVLWPLALNTYAGFQGVPET
LRMAGRNYGLKGLRYVLQVLVPAALPSILSGLKIGWAFAWRTLIAAELVFGASSGKGGLG
WYIFQNRNELYTDRVFAGLAMVVLIGLLVESLGFKTLERLTVRRWGQQR