Protein Info for GFF5145 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Peptidyl-prolyl cis-trans isomerase PpiB (EC 5.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00160: Pro_isomerase" amino acids 40 to 231 (192 residues), 152.3 bits, see alignment E=7.1e-49

Best Hits

KEGG orthology group: K03767, peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC: 5.2.1.8] (inferred from 68% identity to pol:Bpro_2867)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>GFF5145 Peptidyl-prolyl cis-trans isomerase PpiB (EC 5.2.1.8) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTPTSLSLRRRAALWLTALAAGAALLPMAVQAQSATAPRVKLATSQGDIVIELYPDKAPK
TVENFLQYVRDQHYEGTVFHRVIGNFMVQGGGFDGSYKQKPTRPPVAHEGQAALALGGPR
NVVGTVAMARTNDPHSATSQFFINVKDNAFLDPTPIPPGDPVPQFEYRGKIYKDVPRASL
LNAGELYGYTVFGKVVAGMDVVNKIKDMPTGAGGPFPTDVPKTPITILKATLEK