Protein Info for GFF5134 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TPR repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13432: TPR_16
  • amino acids 18 to 75 (58 residues), 30.8 bits, 3e-10
  • amino acids 47 to 109 (63 residues), 28.6 bits, E=1.4e-09
  • amino acids 114 to 177 (64 residues), 30.6 bits, E=3.4e-10
  • amino acids 185 to 243 (59 residues), 36.6 bits, 4.5e-12
• PF03704: BTAD
  • amino acids 43 to 110 (68 residues), 23.5 bits, E=5.2e-08
• PF13174: TPR_6
  • amino acids 43 to 73 (31 residues), 12.3 bits, see alignment (E = 0.00019)
• PF14559: TPR_19
  • amino acids 53 to 111 (59 residues), 29.6 bits, 6.3e-10
  • amino acids 157 to 214 (58 residues), 29.6 bits, 6.1e-10
• PF13431: TPR_17
  • amino acids 64 to 95 (32 residues), 24.5 bits, see alignment (E = 1.8e-08)
  • amino acids 166 to 197 (32 residues), 23 bits, see alignment (E = 5.7e-08)
• PF13374: TPR_10
  • amino acids 75 to 101 (27 residues), 19.5 bits, see alignment (E = 6.7e-07)
  • amino acids 109 to 138 (30 residues), 15.6 bits, see alignment (E = 1.1e-05)
• PF13181: TPR_8
  • amino acids 75 to 104 (30 residues), 19.5 bits, see alignment (E = 7.1e-07)
  • amino acids 110 to 141 (32 residues), 12.9 bits, see alignment (E = 9.4e-05)
  • amino acids 145 to 176 (32 residues), 19.9 bits, see alignment (E = 5.3e-07)
  • amino acids 211 to 243 (33 residues), 23.1 bits, see alignment (E = 5e-08)
• PF07719: TPR_2
  • amino acids 75 to 108 (34 residues), 24.1 bits, see alignment (E = 2.2e-08)
  • amino acids 145 to 176 (32 residues), 24.3 bits, see alignment (E = 1.9e-08)
  • amino acids 211 to 242 (32 residues), 26.1 bits, see alignment (E = 5.2e-09)
• PF13176: TPR_7
  • amino acids 77 to 108 (32 residues), 16.6 bits, see alignment (E = 5.7e-06)
  • amino acids 148 to 175 (28 residues), 14.7 bits, see alignment (E = 2.4e-05)
• PF13424: TPR_12
  • amino acids 109 to 171 (63 residues), 35.5 bits, E=7.8e-12
• PF00515: TPR_1
  • amino acids 211 to 242 (32 residues), 30.6 bits, see alignment (E = 1.8e-10)
• PF13414: TPR_11
  • amino acids 218 to 254 (37 residues), 27.3 bits, 2e-09

Predicted SEED Role

No annotation

Protein Sequence (583 amino acids)

>GFF5134 TPR repeat (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNASLAPAQQMQLAVHYHSQGLLDAARSLYEGVLRQFPAEFAVLYHLGLLESQAGQLERA
AGYFGRAVQSSPQNADALNNLAYTLQQLGRDAEALAAYEQAQALLPDDADIAINLGLLHK
KLRQLPEALACFEHALQAHPAHVALLCNQGNVLQRLGRQQEALSSYERALTAEPDNPVVL
CNLSNALNELARYDEALARAERASQAHPKHAQAWVERGNALKQLGRIPEAVASCEKAIAL
DPAMVQAHTNLAATVLSDSVDTPRVIAAGRKSLEVYLQSVYRAPALRHAGLALSAFRLKH
DVQQAQWLQANGHAVPGLAPFLKTGSALLSQSKDLPPGSALRASARELSSLQEFLATPWL
HAMPDAMPDVLNPENDWLALEEVYLAGTPEILTIDHFLSAPALKAFQDFAHASRVWHGEY
ANSYLGAFANRGFNSPLHLQLARELKQRMPRVFKDYLLTQLWGFKYEPAVTRGINVHADF
AKVNLNFWIAPSEHNLDPESGGLKVYDVPAPADWTFEQYNADSTRIYEFLAQHNAGCVTV
PHRCNRAVLFNSALFHETDTIRFVDRYEARRVNMTYLFGQQLR