Protein Info for GFF5128 in Sphingobium sp. HT1-2

Annotation: Cytochrome c oxidase polypeptide II (EC 1.9.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details PF00116: COX2" amino acids 136 to 206 (71 residues), 60.8 bits, see alignment E=1.2e-20 PF00034: Cytochrom_C" amino acids 233 to 321 (89 residues), 42.5 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 42% identity to rsp:RSP_0118)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>GFF5128 Cytochrome c oxidase polypeptide II (EC 1.9.3.1) (Sphingobium sp. HT1-2)
MRNPWLWTISLRGLGACNAQQSALHVFGAEARQVREMAILLTIGAAIILSIMILIYVRAL
RAPEGALSHHGGMRIILWLGAIGPALILGALLLCALPAMRPRDTAPGDLTIRVEGEQFWW
RVAYGASRAGPGLVSANEIRLPVGRTVILELGAQDVIHSFWIPGLAGKMDMIPGRTNRLV
VRAEKAGRFRGVCAEFCGLSHALMAFDVIAMNPADFDAWLADARGAGRGLGSSRGQSLFD
AHGCGACHAIRGTAHDAAIGPDLSRFGQRRTLGAGILPPTTANIAAFIRAPQIAKPGARM
PAYPQLSEQEAIAIAHYLEGLK