Protein Info for GFF5127 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 178 to 197 (20 residues), see Phobius details PF22491: DUF6988" amino acids 44 to 213 (170 residues), 188.9 bits, see alignment E=3.1e-60

Best Hits

KEGG orthology group: None (inferred from 42% identity to gag:Glaag_3869)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>GFF5127 no description (Variovorax sp. SCN45)
MDIEHLLRRSDELDDTIVRMLELDRYPEHGEDAEKLALSVTAASLSIDHARALRSLIADG
FVSSAVPLMRLQFESTTRSAWLLFAASDGQVALAAAPLSTAGDEAARKLPAAREMIKQLR
GASIAVPAAAPPAAMLGRFEDMQRHALNSFVHVGVHALRRHQDGFPVQLVCQLIECSNGL
VTIAAMMLAILTGDRVLAARMNRVHVGFEDCLTPLLPSY