Protein Info for GFF5124 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF08448: PAS_4" amino acids 28 to 121 (94 residues), 27.4 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 31 to 121 (91 residues), 26.2 bits, see alignment E=2.8e-09 PF00158: Sigma54_activat" amino acids 165 to 331 (167 residues), 224.4 bits, see alignment E=2.5e-70 PF14532: Sigma54_activ_2" amino acids 165 to 336 (172 residues), 74 bits, see alignment E=5.4e-24 PF01078: Mg_chelatase" amino acids 175 to 301 (127 residues), 24 bits, see alignment E=8e-09 PF07728: AAA_5" amino acids 187 to 305 (119 residues), 26.9 bits, see alignment E=1.5e-09 PF02954: HTH_8" amino acids 445 to 483 (39 residues), 50.1 bits, see alignment 6.2e-17

Best Hits

KEGG orthology group: None (inferred from 67% identity to vpe:Varpa_3447)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>GFF5124 Sigma-54 dependent transcriptional regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTRDNRLPRDAQSILELAARSMFDLFANASEGMMLVDRDARVVWINDQYRRFLPALGFER
EEDFVGHPVSRVVQNTQMHQVLATGKPILIDLLTNRAGTFVVSRIPLRDDAGEVIGVLGI
VLFDHPETTLQPLISKFARLEQDLSEARRELASQRRSKYTFASFVGSSAAALEVKRQARR
AAQSASPVLLLGETGTGKELLAHAIHAASPRAGRSFVSVNMAAVPDTLLEAEFFGVAPGA
YTGADKKGRDGKFKLADGGTLFLDELGDMPMSVQVKLLRALQEGEIEPLGSNKLVRFDVR
VVAATSRDLQQMVREGSFREDLYYRLNVLPIRVPPLRERRDDIALLIEALCEDIAARGGG
AQLELNADAQALLAAQPWRGNIRELRNVLEQLALRSDSHHIAGAQVGAVLQEAGLPALAL
ASMPTSAAPRAQAAGEVLRPLPEQIAELEQRAIAQALARTGGNRTAAAKLLGISRASLYD
RLAAQGDASEIQTID