Protein Info for GFF5116 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Inner membrane protein YihY, formerly thought to be RNase BN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 128 to 152 (25 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 8 to 265 (258 residues), 91.8 bits, see alignment E=3.3e-30 PF03631: Virul_fac_BrkB" amino acids 18 to 265 (248 residues), 165.6 bits, see alignment E=9.1e-53

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 34% identity to tra:Trad_2317)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF5116 Inner membrane protein YihY, formerly thought to be RNase BN (Hydrogenophaga sp. GW460-11-11-14-LB1)
LRVILLAIRNYILHQSANQAGSLAFSSVLAMFPLLILLSASAGYLGKPGDAAALVGRVVG
YTPQVVRDVMQPVIEQVLAQRNQALLAVGVVVTLWTASSGMQAIRSALNRAYGIERGLPF
WKARIKVTLFTVVVGSGVLLAFSSVVVMPYVWLLLAENVGVGQETLWARNSVRYGSAFLV
LVMLYALMYGWLPDIRQRLYTVIPGAVVGAALWVGAAASLSYTLRTAGKLALLYGSFAGV
VATLVFLYISATTLIFGAEINGVLRSTEERAGDTA