Protein Info for GFF5111 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 146 to 162 (17 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF00892: EamA" amino acids 3 to 130 (128 residues), 46.9 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 84% identity to vpe:Varpa_0231)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>GFF5111 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MPALALMFNAFVWGVSWFPFRQMASHGLHPLWTTCLIYLAIAVVMGLVRRHAWQGFVAFP
GLVLLGLAAGITNVGFNWAVTQGDVVRVVLLFYLMPLWSVLLGWLLLGERPTGGALARVA
LALSGVVVVLKAPGTDWPVPSSLPDWLGVGAGFSFAVTNIVLRRLRAAPGESRALAMFCG
CTAVAGVAALTGTAFGAVDSPMLASPGWLGWAALLGTGFIVANVCLQYGAPRLAASATSV
IMLSEVLFASVSSVALGAATLDSRILMGGALIVAGALWSAFARTPVPRDDRASAPT