Protein Info for GFF511 in Sphingobium sp. HT1-2

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00072: Response_reg" amino acids 21 to 130 (110 residues), 95 bits, see alignment E=3.2e-31 PF00486: Trans_reg_C" amino acids 173 to 246 (74 residues), 75 bits, see alignment E=4.1e-25

Best Hits

Swiss-Prot: 41% identical to ARUR_PSEAE: Transcriptional regulatory protein AruR (aruR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 61% identity to ccr:CC_1182)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>GFF511 DNA-binding response regulator (Sphingobium sp. HT1-2)
MTLQGSPSIDMLTANMDGSRILVVDDDADIRILLSDFLEQHGFAVTAVADGVAMDQALAA
QTFDIAVLDVMMPGEDGLSILRRLAASGDLPIIMLSAIGGDIDRIVGLEMGAEDYLPKPC
NPRELLARVRTVLRRNRRQTSEPQVPAGQRLRFAGWQVDMGVRLLTDPDNVVVTLTDGEF
RLLRAFIEHPRRVLSRDQLLDYSAGSDAESYDRAIDVQVSRLRRKLERGEMGDELVRTIR
NEGYMFTAEVRPA