Protein Info for GFF51 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: O-antigen flippase Wzx

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 167 to 193 (27 residues), see Phobius details amino acids 236 to 261 (26 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details amino acids 399 to 424 (26 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 54% identity to msl:Msil_2610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>GFF51 O-antigen flippase Wzx (Hydrogenophaga sp. GW460-11-11-14-LB1)
VSRGLLQRVAAGMGANSVGMAITIGTQLASLPLFLAVWDTRTYGVWLMLSALPAYLSMAD
VGMVTAAGNRMTMAMGAGQAPLANRVFQSAQGFVLCVCGALALLVLPGIWWSAWPADATT
DQRLALMALVAGVLVSFLGGLSEQLFKATHRYAQGTLLGNATRLAEWAGWMLGLLLWGSF
AAVAVGGLLCRVAGTLLAMHVARHGAHGLSWGLAHAAPGELRRMVRPAAAFMAFPLANAL
SLQGVTLLVGALLGPVAVAVLNTYRTLARTAVQATAILSHALWPEFARLFGQGALASLRQ
LAWRSAGWGVAQSLLLSAALFVLAPWLLRAWTHGEIGFDPGVFGLLMAYAAVAGLCHVPR
VLLMSINRHGPLALWSLLASALCVAMAWLLSGPMGLTGAAAAMLASEALLTGICLRLAGC
AVAAPAAAPREQGVTP