Protein Info for PS417_26105 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 18 to 123 (106 residues), 56.1 bits, see alignment E=2.2e-19 PF00528: BPD_transp_1" amino acids 37 to 228 (192 residues), 72.9 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 89% identity to pfs:PFLU5634)

Predicted SEED Role

"Arginine transport system permease protein ArtQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UM19 at UniProt or InterPro

Protein Sequence (239 amino acids)

>PS417_26105 ABC transporter permease (Pseudomonas simiae WCS417)
MLEQLSLLSFANGGWGSALLAGALVTITLALACIPLGLPLGLLVALAARSKRRWLRTGAT
VFSTVFRGLPELLTLLIIYYGCQIAAQRMLAAMGYQGEVTINTFVAAMIAFSLVFAAFSS
EVWLSAFKSLSKGQFEAATMLGLPKGTTLRKVVLPQLTRIALPGLSNNWLSLLKDTSLVS
TISLVDLMRQTSLAVSVTKEPMLFYAVACFGYLFFSALSGRVFNFLERYFSRHQLSAKP