Protein Info for GFF509 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 260 to 286 (27 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 313 (279 residues), 110.6 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to vpe:Varpa_3440)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>GFF509 ABC transporter, permease protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MKIDFDWKPLLLAPVLALAALPLTGSFSTWLTLTVAGLAMGMIIFIIASGLTLVFGLMDV
LNFGHGVFIALGAFVASSVLGLMGDWTGSGELWRNLVAVFPAMLVAMAVAGAVGLAFERF
IVRPVYGQHLKQILITMGGMIIGEELIKVIWGPAQIPLPLPEALRGSLLVGDAAISKYRL
LAVAVGVVVFGVLAWTLGRTKIGLLIRAGVQDREMVESLGYRIGRLFVGVFVVGSALAGL
GGVMWGLFQQNLVPQMGAQVNVLIFIVIIIGGLGSTGGALIGALLVGLMTNYIGFLLPTL
TQFASIFLMVAVLLWRPQGVYPVANR