Protein Info for GFF5076 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 189 to 205 (17 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 340 to 357 (18 residues), see Phobius details amino acids 363 to 380 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 174 to 321 (148 residues), 59.6 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_0257)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF5076 hypothetical protein (Variovorax sp. SCN45)
MFWGLVVFMPVGVTYLSALLLLATMLVAGGGRERYARLRANPLWWPVMAYFAWTFIVLAI
GPHYPETGSNLFHGIRIGLTMLMAMALTREEAIWALRGFLLIAALNILLVVVFYAVGGFH
IWSPLRAVVMEVGNKSISNALLFSVVASTAAVWGIAQIAAHKPLRAIPAFVLMLGLGLVV
ALPLTSRTSVLALLLVIPVVCIHQWRSHLKMLVGALVLGAVVMGAGLYQLPQLQHKVETG
VQEIEEAQAGAVFKGSWAIRYYMYRDTGLMIADRPLTGWGIGGWTDQWHKRGPALLADSN
MPHNDFLWVGSQGGLPALLSLLVIMVAAVWQAWKRPDIAGRYALAATLIALIASSVNSAM
RDAQIGLALLFISMVYLRLAQERQDPDPWRGLWPQRLPNPSETP