Protein Info for GFF5076 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 81 to 110 (30 residues), see Phobius details amino acids 128 to 162 (35 residues), see Phobius details amino acids 194 to 233 (40 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 102 to 271 (170 residues), 95.9 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 37% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 79% identity to xau:Xaut_3459)

MetaCyc: 36% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF5076 Alkanesulfonates transport system permease protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNTLTQTLPSTAPASEASSFGTKLQQWLAPSRAIGFLLPAGVLLLWQTAASLEWIDPVFL
PAPIKVVEAFFKMLTEQRLLWDFAVSLSLVSQGFLYGAFAALVLGVGAGLSKRFEQFLSP
TFDTIRHIPGIAWFPLIVLWLGLGAPAKILVIAKTVFFPVFLNTLQGIRSVDKSYIELAE
VMTLTRWQLVRKIILPAATPTIMVSLRYAAGLAWALVVVAEGLSGLEGLGFLIFRAQGLL
LTDQLLVCMVIIGLVGFGIDRTMYLLQRRVLRWKQGFEG