Protein Info for GFF5075 in Variovorax sp. SCN45

Annotation: Two-component system sensor histidine kinase Dtpsy_0212

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details PF00672: HAMP" amino acids 129 to 180 (52 residues), 43.2 bits, see alignment 6e-15 PF00512: HisKA" amino acids 187 to 244 (58 residues), 42.6 bits, see alignment E=7.4e-15 PF02518: HATPase_c" amino acids 288 to 395 (108 residues), 95.3 bits, see alignment E=4.7e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_0258)

Predicted SEED Role

"Copper sensory histidine kinase CpxA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF5075 Two-component system sensor histidine kinase Dtpsy_0212 (Variovorax sp. SCN45)
MLRSLYSRHLYVRIWLAVVGGVVILTLMANWIVREAAQAERERLAPVPRDVIVLDAQDKQ
IGTGKALRVPGQGLEFDVTLSDGKELTLRVAPRERPSGPSGFAPWRTPFGLGWMIALVGV
AVALGVYPIVRRITQRLESLQRGVQRWGEGDLSVRVTEEGQDEVADLSKRFNASAERIEQ
LVRSHKSLLANASHELRSPLTRIRMGLELMGERPSATAREEISRNIGELDQLIDEILLAS
RLDASEADMGTIEPVDLIGLAAEECAQVNAELDLAEGTDNASLTVPGVSRLLRRAIRNLL
ENARRYGAGEISVELGSADGFATVRVNDRGPGVPAALRERIFEPFYRLPGASERNGGVGL
GLALVKSITERHGGSVRCEDRPGGGASFVIRLPTARGH