Protein Info for GFF5073 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Taurine transport system permease protein TauC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 272 (172 residues), 56.1 bits, see alignment E=2e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 77% identity to aaa:Acav_4097)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>GFF5073 Taurine transport system permease protein TauC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLSHALPPIRPEAEYPLPALADTPAERPLPWHQRVWQQAWLRKAVILLALALLWEFLAR
WQDNDLLLPTFGQTAHAFVDGIAGGELLLRARASLAVLLQGYLLGIVAAFALTTLAVSTR
IGRDLLATLTSMFNPLPAIALLPLALLWFGLGQASLVFVLVHSVLWPLALATFAGFQAVP
DTLRMAGRNYGLRGVRYVLLILVPSALPAILSGLKIGWAFAWRTLIAAELVFGVSSGKGG
LGWYIFQNRNELYTDKVFAGLVTVILIGLLVENVVFQTVEKLTIRRWGVAR