Protein Info for PS417_25970 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 240 to 413 (174 residues), 112.6 bits, see alignment E=8.1e-37 PF00990: GGDEF" amino acids 242 to 353 (112 residues), 77.9 bits, see alignment E=3.8e-26 amino acids 368 to 409 (42 residues), 29.7 bits, see alignment 2.5e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU5608)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA39 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PS417_25970 diguanylate cyclase (Pseudomonas simiae WCS417)
MSRVSAVRFNHFLPSLLLLLAGLSAAYVKELNVFFTSLFNVLPTLVLLLGGSYCAVYRRQ
RELFLMITVYIAYFLLDTQTDFYRDHGRVREDAAVVFHLCCLLLPLLFSIYALWQEKTHL
FRDFVARGAVLLAIGSVALALEQSYPQAVLNWLAEIRWPALHGSWMSLIQLSYPMFLIGF
LTLAAQYWYQPRPLHAAQLVGLLGMFWMLPQTFILPFTLNIMCSQVMLMIAAGVAHEAYQ
MAFRDELTGLPGRRALNERMQRLGRNYVLAMSDVDHFKRFNDTHGHDVGDQVLRLVASKL
SKVNGGGRAYRYGGEEFAVVFAGKTVEECLPHLEEIRGIIADYDIKLRNSDRPQDDHQGR
QRRSGSGASSVSVTISIGVAERQAEQRTPEEVLKSADQALYAAKGAGRNCVVAAGQTRRG
AVRMESAAG