Protein Info for GFF5066 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Arginine exporter protein ArgO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 115.3 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 40% identical to ARGO_YERE8: Arginine exporter protein ArgO (argO) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 80% identity to lch:Lcho_4336)

Predicted SEED Role

"Arginine exporter protein ArgO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF5066 Arginine exporter protein ArgO (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTTTFIQGLVLSLGLIVAIGAQNAFVLRQGLRREHVGPVVLFCALADAVLITAGVMGMAQ
ALGDSPGLARALALAGAVFLAVYGWRALKRSRHPQRLSAAGGGEGLSRGAAVAQAAAFTL
LNPHVYLDTVLLVGSIGAQQPATLRGWFIAGASTASLAWFGLLGYGARWLAPCFAQPRAW
QVLDGLIGITMGVLATLLVRHALTGL