Protein Info for GFF5065 in Variovorax sp. SCN45

Annotation: Orotate phosphoribosyltransferase (EC 2.4.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 18 to 198 (181 residues), 180 bits, E=1.8e-57
• PF00156: Pribosyltran
  • amino acids 49 to 166 (118 residues), 42.3 bits, E=2.4e-15

Best Hits

Swiss-Prot: 77% identical to PYRE_POLNA: Orotate phosphoribosyltransferase (pyrE) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 96% identity to vpe:Varpa_0288)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.10

Use Curated BLAST to search for 2.4.2.10

Protein Sequence (227 amino acids)

>GFF5065 Orotate phosphoribosyltransferase (EC 2.4.2.10) (Variovorax sp. SCN45)
MAVDGQKSSAVAQDFVQFALDAGVLRFGEFKTKAGRMSPYFFNSGLFDDGGKIARLAGFY
ADRLIESGLEFDMIFGPAYKGIPLGATVAAELARRGRNYPFAYNRKEAKAHGEGGNLVGA
PLKGRVLIVDDVMSAGTAVRESIAAIQAAGATPHAVAIALDRQEKATENGVDVDHSAVQY
VRNQLGLAVIAIATLDDLLSYLSGSAAADLGTHRDRVLAYRTRYGAS