Protein Info for GFF5065 in Variovorax sp. SCN45

Annotation: Orotate phosphoribosyltransferase (EC 2.4.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR00336: orotate phosphoribosyltransferase" amino acids 18 to 198 (181 residues), 180 bits, see alignment E=1.8e-57 PF00156: Pribosyltran" amino acids 49 to 166 (118 residues), 42.3 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 77% identical to PYRE_POLNA: Orotate phosphoribosyltransferase (pyrE) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 96% identity to vpe:Varpa_0288)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.10

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>GFF5065 Orotate phosphoribosyltransferase (EC 2.4.2.10) (Variovorax sp. SCN45)
MAVDGQKSSAVAQDFVQFALDAGVLRFGEFKTKAGRMSPYFFNSGLFDDGGKIARLAGFY
ADRLIESGLEFDMIFGPAYKGIPLGATVAAELARRGRNYPFAYNRKEAKAHGEGGNLVGA
PLKGRVLIVDDVMSAGTAVRESIAAIQAAGATPHAVAIALDRQEKATENGVDVDHSAVQY
VRNQLGLAVIAIATLDDLLSYLSGSAAADLGTHRDRVLAYRTRYGAS