Protein Info for PS417_25940 in Pseudomonas simiae WCS417

Annotation: pyrroloquinoline quinone biosynthesis protein PqqE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 14 to 373 (360 residues), 613.5 bits, see alignment E=1.1e-188 PF04055: Radical_SAM" amino acids 24 to 179 (156 residues), 96.2 bits, see alignment E=3.9e-31 PF13353: Fer4_12" amino acids 27 to 121 (95 residues), 28.4 bits, see alignment E=2.7e-10 PF13186: SPASM" amino acids 251 to 316 (66 residues), 35.3 bits, see alignment E=1.7e-12 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 258 to 343 (86 residues), 29.8 bits, see alignment E=6.4e-11

Best Hits

Swiss-Prot: 94% identical to PQQE_PSEF5: PqqA peptide cyclase (pqqE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 99% identity to pfs:PFLU5602)

MetaCyc: 74% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7P8 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PS417_25940 pyrroloquinoline quinone biosynthesis protein PqqE (Pseudomonas simiae WCS417)
MQSTGSPLPEKPPIGLPLWLLAELTYRCPLQCPYCSNPLDFAEQGKELSTEQWFKVFREA
REMGAAQLGFSGGEPLVRQDLAELIAEARRLGFYTNLITSGIGLTEQKISDFKKAGLDHI
QISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNIDKIDRIIELC
IALEADFVELATCQFYGWAQLNRVGLLPTREQLVRAERITNEYRAKLEAEGHPCKLIFVT
PDYYEERPKACMNGWGSIFLTVTPDGTALPCHGARQMPVQFPNVRDHSMQHIWYDSFGFN
RFRGYDWMPEPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCSKSEQHGIILQAREEAE
HATQTIEQLAFRNERNSRLIAKG