Protein Info for GFF5064 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 264 to 273 (10 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 317 to 346 (30 residues), see Phobius details amino acids 352 to 378 (27 residues), see Phobius details PF16983: MFS_MOT1" amino acids 18 to 136 (119 residues), 76.4 bits, see alignment E=2.4e-25 amino acids 220 to 337 (118 residues), 115.5 bits, see alignment E=1.8e-37

Best Hits

KEGG orthology group: None (inferred from 72% identity to mms:mma_0186)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF5064 Sulfate permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
LAPVMHSDVSANNRFDRMEWAGAFGDLGTLIPFLAAYIGVLKMDPTGVLFAFGVAMLVCG
LYYRTPFPVQPMKAIGAVAVAQAAQTAVITPGSVVAAALVTGAVWLVLGLTGAARTLARL
VPPTVVAGIVLGLGLGFMLEGVRMMQTAWGLAAVAGAVTLLLMCTRTVPAMFVLLALGAA
VGLYQNPALGAALVNASVQLTTPSFAWGSLSWNDLFIGVVFLALPQIPLTLGNAVIAIKE
ENNRLFPHAPVTEKTVAVSTGLMNVFSSAVGGVPMCHGAGGMAGHVAFGARTGGAVVILG
AVLLALALFFSDSVHVLFQLFPSAVLGVILFFTGAQLALGAGVLGAARDDRLVTLVTAGL
CLWNVAIGLAVGLVLHHLARRGLLRF