Protein Info for PS417_25930 in Pseudomonas simiae WCS417

Annotation: pyrroloquinoline quinone biosynthesis protein PqqC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 7 to 240 (234 residues), 421.3 bits, see alignment E=5.2e-131 PF03070: TENA_THI-4" amino acids 13 to 222 (210 residues), 217.7 bits, see alignment E=8.1e-69

Best Hits

Swiss-Prot: 96% identical to PQQC_PSEPK: Pyrroloquinoline-quinone synthase (pqqC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 97% identity to pba:PSEBR_a5167)

MetaCyc: 76% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

"Pyrroloquinoline-quinone synthase (EC 1.3.3.11)" (EC 1.3.3.11)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4R8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PS417_25930 pyrroloquinoline quinone biosynthesis protein PqqC (Pseudomonas simiae WCS417)
MTDTPLTTAEFEAALRAKGAFYHIHHPYHVAMYEGRATREQIQGWVANRFYYQVNIPLKD
AAILANCPDREIRREWIQRLLDHDGAPGEDGGIEAWLRLGQAVGLDPDQLRSQELVLPGV
RFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDSWPQHYPWIDPAGYEYFRTRLG
QARRDVEHGLAITLQHYTTREGQERMLEILQFKLDILWSMLDAMSMAYELNRPPYHSVTE
QRVWHKGITL