Protein Info for PS417_25920 in Pseudomonas simiae WCS417

Annotation: pyrroloquinoline quinone biosynthesis protein PqqF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 780 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 11 to 686 (676 residues), 721.9 bits, see alignment E=5.4e-221 PF00675: Peptidase_M16" amino acids 20 to 142 (123 residues), 88.4 bits, see alignment E=4.7e-29 PF05193: Peptidase_M16_C" amino acids 180 to 333 (154 residues), 42.3 bits, see alignment E=8.1e-15 amino acids 577 to 688 (112 residues), 33.1 bits, see alignment E=5.2e-12

Best Hits

KEGG orthology group: None (inferred from 83% identity to pfs:PFLU5597)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPN0 at UniProt or InterPro

Protein Sequence (780 amino acids)

>PS417_25920 pyrroloquinoline quinone biosynthesis protein PqqF (Pseudomonas simiae WCS417)
MPAPAHPHPLQLTLANGLQVALQHAPRLKRCAAVLRVAAGSHDVPLAWPGLAHFLEHLLF
LGTERFPTSEGLMAYVQRHGGQVNASTRERTTDFFFELPVATFAGGLERLGDMLTHPRLA
LEDQLREREVVHAEFVAWSQDAKAQQQVALLEGLAADHPLRGFHAGNRDSLPVEREAFQQ
ALREFHAQFYQSGQMTLSLAGPQSLEALQGLAQSFSEQLTSGPLRPQSAPPALMPGQARG
YQHIANHHLHHVITCDAPRPALEFLCTWLNTSAPGGLLAELKTRQLASALQASVLYDYAG
QAVLDIDFTTRGESASQIEALLLDWLSFFAHSDWTSLREEFALLAARQRQVQGALALAKN
HSQDLSEQSVAALKTLLDSLHLPPSGHTWQLPPNNPFLRPPIKEERAGLIRGQTSAHRGL
RTFAQDRSRGRKEVSALTFSQALADDGDEGALYLQWRSAPCGLESALQPLRENARQAGVE
LSFENLGQDGLVKMVGLQEPMPAVLDRLAQSLNQPQEAQPVLPQMIAIRELLKALPACCN
GHNAESTAWATARWQGLGLGFSAAHEAAIKTAAARLPGQPARLDQARPSLSGQRLWHTLK
TDSDEAALLLFCQAPSQSLADEAAWRLLGHLVQGPFYQRLRVELQIGYAVFSGIRQISGQ
TGLLFGVQSPSVSLEGIADHLQAFLQQLPALIDSSDDLGNLALAQQFSAQTLPNAQAAEL
LWHAHLAGHPSGYLDQLQSHIQACTREALQLAAQQLNDATGGWRCVANGPCSSATWQAAG