Protein Info for GFF5060 in Pseudomonas sp. DMC3

Annotation: HTH-type transcriptional regulator ArgP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR03298: transcriptional regulator, ArgP family" amino acids 2 to 292 (291 residues), 365.8 bits, see alignment E=6.8e-114 PF00126: HTH_1" amino acids 5 to 62 (58 residues), 53.7 bits, see alignment E=1.6e-18 PF03466: LysR_substrate" amino acids 89 to 276 (188 residues), 47.9 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 95% identical to ARGP_PSEPF: HTH-type transcriptional regulator ArgP (argP) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 95% identity to pfo:Pfl01_4483)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF5060 HTH-type transcriptional regulator ArgP (Pseudomonas sp. DMC3)
MFDYKLLSALAAVVEQAGFDRAAQVLGLSQSAISQRIKLLEARVGQPVLVRGTPPAPTEI
GRRLLNHVQQVRLLERDLQSVVPALDEEGLPDRLRIALNADSLATWWAAAVGGFCAEQHL
LLDLIVEDQTVGLKRMRAGEVAACLCASERPVAGARSVLLGAMRYRALASPAFIARHFPD
GVRAEQLPRTPALVFGPDDFLQHRYLALLGVDGAFEHHLCPSSEGFIRLTEAGLGWGLVP
ELQVREQLQRGVLRELLPDKPIDVPLYWHHWRNGGQLLNLLTEQLLRSSKQWLVA