Protein Info for GFF5058 in Variovorax sp. SCN45

Annotation: Rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 38 (1 residues), see Phobius details amino acids 43 to 71 (29 residues), see Phobius details amino acids 83 to 97 (15 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 134 to 159 (26 residues), see Phobius details TIGR03426: rod shape-determining protein MreD" amino acids 16 to 158 (143 residues), 91.7 bits, see alignment E=2.2e-30 PF04093: MreD" amino acids 16 to 157 (142 residues), 69.2 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 94% identity to vpe:Varpa_0295)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF5058 Rod shape-determining protein MreD (Variovorax sp. SCN45)
MIKRPGQQQLLLPVSPFFMWASLVAALLVNMVPIGRAVWMPDLLALVIVFWGVHQPSRVG
IGAAFVFGLCMDVHQSSMLGQHALSYTTLGFFAITIHRRLLWYPVLSQALQVLPLFALSQ
VIEVITRMIGGGVFPGWTVLISPAIEAALWPLATALLLAPQRRTPEPDENRPL