Protein Info for GFF5055 in Variovorax sp. SCN45

Annotation: BUG/TctC family periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF03401: TctC" amino acids 48 to 320 (273 residues), 293.6 bits, see alignment E=6.1e-92

Best Hits

Swiss-Prot: 43% identical to YCLC_PSEPU: UPF0065 protein in clcB-clcD intergenic region from Pseudomonas putida

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_0298)

Predicted SEED Role

"Tricarboxylate transport protein TctC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>GFF5055 BUG/TctC family periplasmic protein (Variovorax sp. SCN45)
MKTVFTLTRRAAAVALLAVPFFAHAADYPSKPIKFVVPYTPGGTTDLVARTVGQKVSEKL
GQPVLIDNRGGAGGNIGMDVVAKSAPDGYTIGFGAISTNALNPHIYKSMGFDPRKDFTAI
SLLGTSTIVLEVPAASAIKTVPDLIAAAKKNPGLPYATAGAGTSMNLAGVMFAQMTGTDL
VHVAYKGSGPAITDMLGNNIGVMFDNLPASLPHIQAGKLRALAVAGPTRSPSLPDVPTMA
EAGLKGYALEPWFGVYGPANLPAPVVKALNEAFVEALAMPDVKAKLAQAGFSPRGSTPQE
LAKLSDTEYKRLGDVAKKAGMSAD