Protein Info for PS417_02575 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 71 to 88 (18 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU0535)

Predicted SEED Role

"FIG003573: hypothetical protein" in subsystem CBSS-262719.3.peg.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U410 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PS417_02575 membrane protein (Pseudomonas simiae WCS417)
MRALAEFIMRGRVQATLVVAGCAALPLLYWLGAAAGCLVLLRRGLQDAIGVLALGVVAAL
IWWLQLGEPKVLLVLLGSSSLALVLRASESWVRTLLVSVALGLVFSVLIDAAFRPQIEAL
SQEIVKILPMALGELYQQLSVEERARLATLIAPALIGLMAVMMQIVSLLSLMLGRYWQAL
LYNPGGFGREFRSIRIPVGPAMLLLALMVVGPYFGSHAALLVLFCSVPLVFSGLALMHGL
VAQKRLAKFWLVGMYVTMLVFMQLIYPLLVVLAIVDGLIDFRGRLAPKDADNANGEG