Protein Info for GFF505 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF00578: AhpC-TSA" amino acids 45 to 164 (120 residues), 44.2 bits, see alignment E=2.7e-15 PF08534: Redoxin" amino acids 45 to 172 (128 residues), 42.7 bits, see alignment E=7.5e-15 PF13905: Thioredoxin_8" amino acids 68 to 163 (96 residues), 42.8 bits, see alignment E=8.7e-15

Best Hits

KEGG orthology group: None (inferred from 81% identity to vpe:Varpa_3436)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>GFF505 no description (Variovorax sp. SCN45)
MKNMLSRRAFSGLAAGASALVAAAGGGWPVRSAFAAPPVLREYGKAPEFAGIDKWLNSEP
LTLRSLAGQVVLVDFWTYSCINCIRTLPHVVSWYEKYKDQGFVVVGVHSPEFAYEKLTRN
VEDAIRRFNIRYPVAQDNAFATWKAYDNQYWPAFYLVDSKGQVMRQHFGEGEYAEMETAI
EALLSRKSAV