Protein Info for GFF5044 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonate utilization operon LysR-family regulator CbI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF00126: HTH_1" amino acids 3 to 63 (61 residues), 51.7 bits, see alignment E=7.1e-18 PF03466: LysR_substrate" amino acids 91 to 291 (201 residues), 151.2 bits, see alignment E=2.8e-48

Best Hits

Swiss-Prot: 58% identical to SSUR_BURCJ: HTH-type transcriptional regulator SsuR (ssuR) from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)

KEGG orthology group: K13635, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 76% identity to lch:Lcho_3810)

MetaCyc: 47% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Alkanesulfonate utilization operon LysR-family regulator CbI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF5044 Alkanesulfonate utilization operon LysR-family regulator CbI (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNFQQLRSVREAARCGYNLTEVAAMLYTSQPGVSRQIRELEEELGVTIFARAGKRLTGLT
GPGQTLLPIVERLLQEADNLRSAGKEFVSRLEGGLSIAATHSQARYALPHAVRDFRALFP
QVTLNLHQGSPKQVAEMLIAGEADIGIATEALANYPQLVTLPCYRWTHSVVVPHGHPLLR
VEGPLSLHQLAEHPIITYDLGYTGRSHIDDAFKKQGVQPNVVITAMDADVIKTYVELGMG
VGIVASIAVDPDRDRHLHALDARHLFEINVTRLAVRRGTWLRGYAYSFIENFAPSLTRQI
VEEALNDEIVTV