Protein Info for GFF5043 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 36 to 149 (114 residues), 57.3 bits, see alignment E=3.6e-19 PF21706: FCSD_central" amino acids 168 to 281 (114 residues), 144.9 bits, see alignment E=2.2e-46 PF09242: FCSD-flav_bind" amino acids 360 to 425 (66 residues), 73 bits, see alignment E=4e-24

Best Hits

Swiss-Prot: 47% identical to DHSU_ALLVD: Sulfide dehydrogenase [flavocytochrome c] flavoprotein chain (fccB) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 62% identity to tmz:Tmz1t_0627)

MetaCyc: 47% identical to flavocytochrome c flavoprotein subunit (Allochromatium vinosum)
RXN-8156 [EC: 1.8.2.3]

Predicted SEED Role

"Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-)" in subsystem Sulfur oxidation (EC 1.8.2.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.2.-

Use Curated BLAST to search for 1.8.2.- or 1.8.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>GFF5043 Sulfide dehydrogenase [flavocytochrome C] flavoprotein chain precursor (EC 1.8.2.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKQLLQRRHFLATAGGTVAALALPGCASVSSAPKARVVVIGGGFGGATAAKYIRQWAPEI
EVVLVEREAAFVSCPLSNLVLGGTEKIENLTTGYDALQKKHGVRVVRDEATAIDAARKEV
RLARGDTLKYDRLIVSPGVDFQFDQVPGLQSAEAQSQVLHAWKAGPQTVALRKQLEALPD
GGVYALHIPKAPYRCPPGPYERAAQVAFYFKQHKPRSKVLVLDANPDITSKKALFLKAWN
ELYPGIVEYKPNSEIVRVDAANRTVELQFETVRAGVLNVVPPQQAGRIAQTAGLITANNK
WCGVNFQTFESTVAPGIHVLGDATLSAPGMPKSGFMANNHAKVAADAVIALIQGRPVNAE
PIIANTCYSFVSDTDVVHVASVHKWNTEQKTLVAVNGAGGLTPTANALEGQYARSWAKNI
WADALL