Protein Info for PS417_25825 in Pseudomonas simiae WCS417

Annotation: sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 9 to 96 (88 residues), 70.8 bits, E=5.8e-24

Best Hits

Swiss-Prot: 97% identical to GLPE_PSEFS: Thiosulfate sulfurtransferase GlpE (glpE) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 97% identity to pfs:PFLU5581)

MetaCyc: 50% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

See A0A1N7U4P7 at UniProt or InterPro

Protein Sequence (109 amino acids)

>PS417_25825 sulfurtransferase (Pseudomonas simiae WCS417)
MSEFKRIPPEQAQALREQGAVVVDIRDQPTYAAGHITGAQHLDNVNIADFIRAADLDAPV
IVACYHGNSSQSAAAYLISQGFSDVYSLDGGFELWRTTYPAEISSGNSQ