Protein Info for PS417_25805 in Pseudomonas simiae WCS417

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 6 to 325 (320 residues), 425.5 bits, see alignment E=7.9e-132 PF04166: PdxA" amino acids 33 to 321 (289 residues), 366.1 bits, see alignment E=7.2e-114

Best Hits

Swiss-Prot: 90% identical to PDXA_PSEPK: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 98% identity to pfs:PFLU5577)

MetaCyc: 62% identical to 4-hydroxythreonine-4-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
4-hydroxythreonine-4-phosphate dehydrogenase. [EC: 1.1.1.262]

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIJ9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>PS417_25805 4-hydroxythreonine-4-phosphate dehydrogenase (Pseudomonas simiae WCS417)
MKPQRFAVTPGEPAGIGPDLCLLLASQPQPHPLIAITSRDLLLERAAQLGVAVNLLEVEP
GNWPDLPAPAGSLYVWDTPLQAKVVAGQLDKANAAFVLETLTRAGQGCIDGDFAGMITAP
VHKGVINESGIAFSGHTEFLAELTHTEQVVMMLATRGLRVALVTTHLPLREIADAITVER
LERVTRILHADLQQKFGIARPRILVCGLNPHAGEGGHLGHEEIDIIEPTLERLRQEGMDL
RGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYKGFGAAVNVTLGLPIIRTSVDHGTA
LDLAGSGKIDTGSLHVALETAYQMAETRI