Protein Info for GFF5034 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 200 to 360 (161 residues), 134.8 bits, see alignment E=1.2e-43 PF00990: GGDEF" amino acids 205 to 358 (154 residues), 142.5 bits, see alignment E=1e-45

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_4451)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>GFF5034 hypothetical protein (Pseudomonas sp. DMC3)
LTHNAIQRLLLKRFALAAATYGLALLLLWLAFFTGHYQQSLSGVAIGSALVVISQASLFA
MFWSGRNQRFADPSLTEAQVLMGLGWQTWLIAHVDEARGAFLVFYVLILLFGLFHLTRRV
FIRCALLVFFSFSAITLWDAYHFRLAEPALAALQVCILAMVLAWLVLYARFVQVSRQRQR
QRRFALQAHQDTLRGMMRQLEDLVATDELTGLFNRRHFLRIASRELNALDSDVMHGLALI
DLDHFKRINDLHGHAAGDQVLQAFAGVAQACLRDGDVLARYGGEEFVVLVPDCDAERLTA
CCERLRIAFSEVELMGLQVRNLSLSAGMTLLAVGDDLDEALQRADQALYRAKRDGRNRCA
AAWENIDA