Protein Info for GFF5032 in Variovorax sp. SCN45

Annotation: ABC-type spermidine/putrescine transport system, permease component I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 68 to 93 (26 residues), see Phobius details amino acids 104 to 128 (25 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 104 to 276 (173 residues), 37.6 bits, see alignment E=9.8e-14

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 92% identity to vap:Vapar_0307)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>GFF5032 ABC-type spermidine/putrescine transport system, permease component I (Variovorax sp. SCN45)
MSTSKSKATPWWLSGPALVLFTALLLVPLALTAVLSFNVYDPATGPKSGEFTLAHYALVF
SDSYYLGIFWRTFWVSALVTLICVLVGAPEAYVLSRMRNPWRSALLLVVLAPLLVSVVVR
AFGWSMLLGPEGAVNALLRLVGIGPVKILYTNAAVVIALVHVMLPFMVIPVWTSLQKLDP
GVENAALSLNATPFTTLRRIVLPQVMPGILSGSLLVFGLAASSFAIPGLLGGRRLKMVAT
IVYDEYLSELNWPLGAAVALVLLVANLVVMLSYNRLVEGRYKKALG