Protein Info for GFF5031 in Variovorax sp. SCN45

Annotation: ABC-type spermidine/putrescine transport systems, ATPase components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 125 bits, see alignment E=3.5e-40 PF08402: TOBE_2" amino acids 276 to 347 (72 residues), 45.3 bits, see alignment E=7.9e-16

Best Hits

Swiss-Prot: 46% identical to FBPC_AGRFC: Fe(3+) ions import ATP-binding protein FbpC (fbpC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 88% identity to vap:Vapar_0308)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF5031 ABC-type spermidine/putrescine transport systems, ATPase components (Variovorax sp. SCN45)
MSFLRLTDVTKFYGATRAVSAMNLAVEKGEFVSLLGPSGCGKTTTLQMIAGFEAVSSGRI
ELAGKDITHAKANTRGLGIVFQTYALFPHMTVADNVSFGLEMRKMPKAERTERVKQALAL
VHLEAHAARYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDAKLREEMQFELRQIQ
RKVGTTTVMVTHDQSEAMSISDRVVVMEGGCATQIDHPQRVYEHPSTRFISTFVGKANLL
DCRVSGSGAARTCVEVGALSLDVDDTGFRVDTAALLSVRPEKLQLVPTGRGRIDGEVQER
FFLGSQWLYRIATPVGDLTVLSPNDGRDALEEGSRTGIDWPAHCMRLLPVEEKAVAA