Protein Info for GFF5030 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Alkanesulfonates-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 94 to 358 (265 residues), 225.7 bits, see alignment E=3.7e-71 PF04069: OpuAC" amino acids 103 to 283 (181 residues), 38.2 bits, see alignment E=2.6e-13 PF13379: NMT1_2" amino acids 107 to 261 (155 residues), 37.9 bits, see alignment E=3.6e-13 PF12974: Phosphonate-bd" amino acids 121 to 241 (121 residues), 34.9 bits, see alignment E=2.2e-12 PF09084: NMT1" amino acids 124 to 281 (158 residues), 63.5 bits, see alignment E=5.5e-21

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 74% identity to vap:Vapar_2978)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF5030 Alkanesulfonates-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSKPFNAADLRRHIAQLLAVTAASWSIAAAKARSVLTTTRNTTHIMSNDFSNRRRFVLTG
VGAAALASLPGLPAQAQTANRVFRVGHQKGFLSLLKGRGTLEQRLAPLGVKISWTEFTAG
PVQLEALNVGSIDFGDVGEAPPIFAQAAGAPLAYVAATVPRPATEAVLVPKDSPIKTVAD
LKGKKVAYNKGSNVHYFLVKLLEKNGLKYDDVQSVFLPPADARAAFEKGAVDAWVIWDPF
LAAAEVGLNGRILADATGVVNNRAYYFSTLDYAARNADVIKIVIEEINKLDQWGSANRDA
LAAEFAPLWGLPKPVVDRSVTRQVYGTGPITKAILQEQQVIADTFFNLKLIPKKINVLEA
AVNAG