Protein Info for GFF5022 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13404: HTH_AsnC-type" amino acids 5 to 46 (42 residues), 65.9 bits, see alignment E=4.6e-22 PF13412: HTH_24" amino acids 5 to 52 (48 residues), 72.2 bits, see alignment E=4.1e-24 PF01037: AsnC_trans_reg" amino acids 68 to 150 (83 residues), 88.7 bits, see alignment E=3.6e-29

Best Hits

Swiss-Prot: 54% identical to DECR_ECO57: DNA-binding transcriptional activator DecR (decR) from Escherichia coli O157:H7

KEGG orthology group: K05800, Lrp/AsnC family transcriptional regulator (inferred from 68% identity to rme:Rmet_0395)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>GFF5022 Transcriptional regulator, AsnC family (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVNALDNTDRAILELLQKDATLSVNEIGERVNLSSTPCWRRIQRLEREGYIQRRVALLDP
EKLNVGVTVFVAIKTNQHNDKWFRKFADVVSTIPQIVEFYRMSGENDYLLRVVVPDIKAY
DAVYQRMIREIELSDVSSSFAMEQIKYTTALPLDYA