Protein Info for GFF502 in Pseudomonas sp. DMC3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 29 to 54 (26 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 106 to 132 (27 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 71 to 165 (95 residues), 90 bits, see alignment E=6e-30 PF00528: BPD_transp_1" amino acids 90 to 269 (180 residues), 84.5 bits, see alignment E=4.1e-28

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 86% identity to pfl:PFL_6154)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF502 hypothetical protein (Pseudomonas sp. DMC3)
MTSFPTPPQPPQPVAETRLQKLFGFRTRLYLTWAALFCLFAGFFLSFDLKFAIILDKLPN
LLGLKLAPNGFLQGAALTLFLCACSIIASSLLGFITALARLSNSAVAFGIASFYTSFFRG
TPLLIQILLIYLGLPQLGIVPGAIVAGIIALSLNYGAYLSEIFRAGILGVDHGQREASLA
LGLRESVIFWRITLPQAMRTIIPPTTNQFISMLKDSSLISVMGVWEVMFLAQSYGRSSYR
YIEMLTTAAIIYWLLSIGLELIQARMERHYGKAYVRRG