Protein Info for GFF5017 in Variovorax sp. SCN45

Annotation: Translation initiation factor SUI1-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR01158: putative translation initiation factor SUI1" amino acids 24 to 125 (102 residues), 114.8 bits, see alignment E=8.7e-38 PF01253: SUI1" amino acids 48 to 117 (70 residues), 63.9 bits, see alignment E=8e-22

Best Hits

KEGG orthology group: K03113, translation initiation factor 1 (inferred from 90% identity to vpe:Varpa_0342)

Predicted SEED Role

"Translation initiation factor SUI1-related protein" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF5017 Translation initiation factor SUI1-related protein (Variovorax sp. SCN45)
MATTKSNQAGSTLVYSTEAGGRMCPGCGAPVAQCRCKELNARLPATDGIVRVSHETKGRK
GKGVTVVKGVALDAAGLTALGKQLKTACGSGGTVKDGVIEIQGDHRELVIAALVKQGHTV
KRAGG