Protein Info for PS417_25700 in Pseudomonas simiae WCS417

Annotation: cyclic AMP receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00027: cNMP_binding" amino acids 23 to 113 (91 residues), 70.6 bits, see alignment E=1.3e-23 PF13545: HTH_Crp_2" amino acids 146 to 207 (62 residues), 45.7 bits, see alignment E=7.6e-16 PF00325: Crp" amino acids 170 to 200 (31 residues), 45.3 bits, see alignment 8.4e-16

Best Hits

Swiss-Prot: 83% identical to VFR_PSEAE: Cyclic AMP receptor-like protein (vfr) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 97% identity to pfs:PFLU5556)

Predicted SEED Role

"Vfr transcriptional regulator / Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria or Quorum sensing regulation in Pseudomonas

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U268 at UniProt or InterPro

Protein Sequence (214 amino acids)

>PS417_25700 cyclic AMP receptor protein (Pseudomonas simiae WCS417)
MVALTPIPKIKNLDKLLMHCQRRRHPAKHNIICAGERSETLFFIIKGSVTILIEDDDGRE
MIIAYLNTGDFFGELGLFEQAGKEQERSAWVRTKVECEVAEISYAKFRELSQHDPDILYA
LSGQIAQRLRDTTRKVGDLAFFDVTGRVARCLLDLCKQPDAMTHPDGMQIKVTRQEIGRI
VGCSREMVGRVLKDLEERNLVHVKGKTMVVFGTR