Protein Info for GFF5013 in Variovorax sp. SCN45

Annotation: Citronellyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF02771: Acyl-CoA_dh_N" amino acids 4 to 118 (115 residues), 109.3 bits, see alignment E=2.9e-35 PF02770: Acyl-CoA_dh_M" amino acids 122 to 217 (96 residues), 77.2 bits, see alignment E=1.8e-25 PF00441: Acyl-CoA_dh_1" amino acids 229 to 377 (149 residues), 143.9 bits, see alignment E=8.5e-46 PF08028: Acyl-CoA_dh_2" amino acids 255 to 355 (101 residues), 52.9 bits, see alignment E=9.6e-18

Best Hits

Swiss-Prot: 53% identical to IVD_CAEEL: Probable acyl-CoA dehydrogenase 6 (acdh-6) from Caenorhabditis elegans

KEGG orthology group: K11731, citronellyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 96% identity to vpe:Varpa_0338)

MetaCyc: 64% identical to citronellyl-CoA dehydrogenase (Pseudomonas aeruginosa PAO1)
1.3.8.-

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.4, 1.3.99.-

Use Curated BLAST to search for 1.3.8.4 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF5013 Citronellyl-CoA dehydrogenase (Variovorax sp. SCN45)
MQYTHEHLEIQKTLRRFIDEEINPRVDEWEEAEIFPAHEIFKKLGNLGLLGLNKPEAFGG
GGLDYSYAMAMAEALGHISCGGVPMAIGVQTDMCTPALARFGSDELRREFLAPAIAGDMV
GCIGVSEPGAGSDVAGLKSHARKDGGDYLISGQKMWITNSLQADWMCMLVNTSDGPVHRN
KSLVMVPMDSPGIEKAKKIRKIGMNSSDTGLIYFDNVRVPQRYRVGEEGQGFVYQMQQFQ
EERLWAAASSLEPMEDCIAQTIEWAQQRSMFGATLADQQWVQFKLAELKTEVEALRALTY
RACDLHVQGQDVLELASMAKLKTGRLTRQVADTCLQFWGGMGFTLENRVSRLFRDGRLGS
IGGGADEVMLGILAKTMGIAKRPPRG