Protein Info for GFF5012 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: putative methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 218 to 238 (21 residues), see Phobius details PF13714: PEP_mutase" amino acids 1 to 244 (244 residues), 166.1 bits, see alignment E=1.1e-52 PF00463: ICL" amino acids 58 to 172 (115 residues), 56.4 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 42% identical to DML_EUBBA: 2,3-dimethylmalate lyase (Dml) from Eubacterium barkeri

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 84% identity to pol:Bpro_1029)

MetaCyc: 42% identical to 2,3-dimethylmalate lyase subunit (Eubacterium barkeri)
2,3-dimethylmalate lyase. [EC: 4.1.3.32]

Predicted SEED Role

"putative methylisocitrate lyase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.30

Use Curated BLAST to search for 4.1.3.30 or 4.1.3.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>GFF5012 putative methylisocitrate lyase (Hydrogenophaga sp. GW460-11-11-14-LB1)
LRRLLQTGEIVMAPGAPDAITARLVQKAGFPAVYMTGFGATASRLGTPDIGLLSQTEMTG
HARDMVRAVDIPVIADADTGYGGPSNIHRTVREYLQAGVAAIHLEDQVAPKRCGQMAGIR
LMDAGENVRRLCCAVESRGDGDLLIIGRTDALPAAGIDEAVRRAKLYQAAGVDLVFVDGI
KTVAEVEAVARAVEGPKVVSLVDGTPAAALTAAQLQSMGFAVVFYAVTALFTAVRAVSGA
LAELKRAGTPLGAAGGMVSYAEFTELVDLDFHKGLDDRFGA