Protein Info for GFF501 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane metabolite transport protein YhjE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 141 (46 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 23 to 226 (204 residues), 86 bits, see alignment E=2.7e-28 amino acids 270 to 438 (169 residues), 36.5 bits, see alignment E=2.9e-13 PF07690: MFS_1" amino acids 29 to 274 (246 residues), 56.6 bits, see alignment E=2.2e-19 amino acids 282 to 435 (154 residues), 50 bits, see alignment E=2.2e-17 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 30 to 425 (396 residues), 500.8 bits, see alignment E=1.5e-154

Best Hits

Swiss-Prot: 94% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sty:STY4194)

Predicted SEED Role

"Inner membrane metabolite transport protein YhjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>GFF501 Inner membrane metabolite transport protein YhjE (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQATATTLDHEQEHVPVNSRNKVVIASLIGTAIEFFDFYIYATAAVIVFPLIFFPQGDPT
AATLQSLATFAIAFVARPIGSALFGHFGDRVGRKVTLVASLLTMGISTVIIGLLPGYATI
GIFAPLLLALARFGQGLGLGGEWGGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGT
FLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHETPVFAKVAAAKKQVKIPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTYSTAAAPVGLGLPRNEILWMLMMAVIG
FGVMVPIAGLLADAFGRRKSMVIITTLIILFALFAFTPLLGSGNPALVFVFLLLGLSLMG
LTFGPMGALLPELFPTEVRYTGASFSYNVSSILGASVAPYIAAWLQSHYGLAAVGVYLAS
MAALTLIALLLTHETRHQAL