Protein Info for PS417_25665 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details PF03653: UPF0093" amino acids 2 to 142 (141 residues), 186 bits, see alignment E=4.9e-59 TIGR00701: TIGR00701 family protein" amino acids 3 to 142 (140 residues), 170.5 bits, see alignment E=1.1e-54 PF05425: CopD" amino acids 49 to 139 (91 residues), 41.5 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: K08973, putative membrane protein (inferred from 94% identity to pfo:Pfl01_5103)

Predicted SEED Role

"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UPH8 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PS417_25665 membrane protein (Pseudomonas simiae WCS417)
MLYLWIKAFHIVSIVCWFAGLFYLPRLFVYHAQSEDTVSKERFSVMERKLYRGIMGPAMV
ATLIFGGWLIYLNPSIFHAGAWIHAKLTLVVLLIGYHHMCGAQVKRFARGENTRSHVFYR
WFNEVPVLILLAIVILVVVKPF